DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and Prss45

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:303 Identity:87/303 - (28%)
Similarity:128/303 - (42%) Gaps:73/303 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IYICMCVCLVLQEQ----VAANFLIPSCGVSY------ESNVATRIVRGKEAMLKSAPFMAYLYY 64
            |.||....|:|..:    ...|:..|.||..:      ||:              ..|:.|.|..
Mouse    19 ILICFAALLLLPPRPNLGYNENYTEPVCGTPWWPDNLEESH--------------HWPWEASLQI 69

  Fly    65 SSEIHCGGTIISSRYILTAAHCM---RPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKY 126
            ..:..|||.:|...::::||||:   :.| .|.||...:..|    |.|.:......||::..||
Mouse    70 EDKHVCGGALIDRSWVVSAAHCIQGNKEY-SVMLGSSTLHPN----GSSWTLKIPVGDIIIHPKY 129

  Fly   127 KRFDR-FLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQ--------AFGWGQTETNH 182
              :.| |:.:|||||.|...:.||.::|||||       |. |.|.        ..||||.:.:.
Mouse   130 --WGRNFIRSDIALLCLETPVTFNKYVQPICL-------PE-HNFNFKVGTKCWVTGWGQVKQHS 184

  Fly   183 SANVLQTTVLTR-----YDNRHCRSVLS--------MP-ITINQLCVGFQGSDTCSGDSGGPLVT 233
            ||.:.....|..     .||::|.|:..        :| |..|.:|....|.|.|.||.||||..
Mouse   185 SAQLTPAPELWEAEVFIIDNKNCDSIFHKKTLYPQVVPLIRKNMICTTNYGEDLCYGDPGGPLAC 249

  Fly   234 KVNYDGVWRYLQLGIVSFGDDKCQSP---GVYTYVPNYIRWIR 273
            ::  ||.|  :..|:.|: :..|.:.   .|||.:..|..||:
Mouse   250 EI--DGRW--ILAGVFSW-EKACATVPNLSVYTRITKYTIWIK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 74/256 (29%)
Tryp_SPc 45..273 CDD:238113 75/256 (29%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 76/263 (29%)
Tryp_SPc 59..286 CDD:214473 74/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.