DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG30288

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:290 Identity:95/290 - (32%)
Similarity:149/290 - (51%) Gaps:24/290 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSISLASTSIYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYS 65
            |.:.:....|..|:.:.::..|  :...|...||.:..:....||..|::|.::|.|:|..:..|
  Fly     1 MRLPIRQLVIVACLFIGIIRTE--SGRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMIS 63

  Fly    66 SEIHCGGTIISSRYILTAAHCMRP-YLKVRLGEHDITRNP--DCQGGSCSPPAEEFDIVLATKYK 127
            .:..|||::|::|::|||.||:.| |:.|||||:| ||:|  ||....|:|.|...|:       
  Fly    64 GKAVCGGSLITARFVLTAEHCISPMYMNVRLGEYD-TRHPIFDCDDFVCTPRAYNVDV------- 120

  Fly   128 RFDRFLAN-----DIALLKLSRNIRFNVHIQPICLILNPAAAPN---VHEFQAFGWGQTETNHSA 184
              ||.:.:     ||.||::.|::.|:.:::||||||......|   :..|...|||........
  Fly   121 --DRKIVHSNPGYDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQ 183

  Fly   185 NVLQTTVLTRYDNRHCRSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIV 249
            :.|||..|.:.....|... ..|:.|:.:|.|...||:|.|||||||.....::|..|..|.|:.
  Fly   184 DRLQTATLQQLPQWSCERP-GRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVA 247

  Fly   250 SFGDDKCQSPGVYTYVPNYIRWIRYVMQSN 279
            |.|...|...|:||.|.::..||..|:|::
  Fly   248 SQGLRLCSGLGIYTNVTHFTDWILDVIQNH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 84/238 (35%)
Tryp_SPc 45..273 CDD:238113 84/238 (35%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 84/238 (35%)
Tryp_SPc 45..270 CDD:238113 82/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.