DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG30287

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:284 Identity:90/284 - (31%)
Similarity:144/284 - (50%) Gaps:9/284 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LASTSIYICMCVCLV-LQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEI 68
            :.:.::.:.:.:.|| |:.|...:.|.|.|..:.......|::.||.|.|.|.|:|..:.....:
  Fly     1 MGAGAVQLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMM 65

  Fly    69 HCGGTIISSRYILTAAHC---MRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD 130
            .|||::|:.||:||||||   .:..|.||||::|:.:..||....|.|...|.::........:.
  Fly    66 KCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYT 130

  Fly   131 RFLANDIALLKLSRNIRFNVHIQPICLIL-----NPAAAPNVHEFQAFGWGQTETNHSANVLQTT 190
            .|..||||||:|...:::..:|:.|||::     :.....|:.:|...|||:||:..::.|||..
  Fly   131 NFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQA 195

  Fly   191 VLTRYDNRHCRSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDK 255
            .||.:...:|..|....:..:.:||......||.|||||||..:|......|.:..|:||:|...
  Fly   196 SLTHHHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVH 260

  Fly   256 CQSPGVYTYVPNYIRWIRYVMQSN 279
            |..|.|||.|.::..||....:.|
  Fly   261 CFGPTVYTNVIHFANWIELHTKKN 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 80/235 (34%)
Tryp_SPc 45..273 CDD:238113 80/235 (34%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 80/235 (34%)
Tryp_SPc 42..280 CDD:238113 81/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.