DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG30286

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:257 Identity:102/257 - (39%)
Similarity:157/257 - (61%) Gaps:17/257 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ANFLIPSCGVSYESNVATRIVRGKE--AMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCMR 88
            |.||.|.||  |.|..|   ::.:|  |.:..:|:||||:.|.|:.||||:::.|:|||||||:|
  Fly    19 AQFLEPDCG--YMSPEA---LQNEEHQAHISESPWMAYLHKSGELVCGGTLVNHRFILTAAHCIR 78

  Fly    89 --PYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATK---YKRFDRFLANDIALLKLSRNIRF 148
              ..|.|||||.:...:.||.|..|.||:|:|:|.:|.:   |.|.:|.  :||.||:|::::.:
  Fly    79 EDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRI--HDIGLLRLAKSVEY 141

  Fly   149 NVHIQPICLILNPAAAPNV---HEFQAFGWGQTETNHSANVLQTTVLTRYDNRHCRSVLSMPITI 210
            .|||:|||||.|....|.:   |...|.|||::.:..:.::|::..:||.:...|.....:....
  Fly   142 KVHIKPICLITNTTLQPKIERLHRLVATGWGRSPSEAANHILKSIRVTRVNWGVCSKTYWVDRRR 206

  Fly   211 NQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQSPGVYTYVPNYIRWI 272
            :|:||..:...:||||||||:...:..||...::|:||||:|:.:|.||.|:|.|..:|.||
  Fly   207 DQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSPSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 91/237 (38%)
Tryp_SPc 45..273 CDD:238113 93/238 (39%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 92/232 (40%)
Tryp_SPc 39..268 CDD:214473 90/230 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463301
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.