DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG30187

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:266 Identity:96/266 - (36%)
Similarity:145/266 - (54%) Gaps:23/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAA 84
            |::..|:.||...||:    |:|.:|..|..|..:::.:||.::..:...||||:|..|::||||
  Fly    15 LKDVGASIFLDQICGI----NIALKITGGHNAAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAA 75

  Fly    85 HCM--RPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD--RFLANDIALLKLSRN 145
            ||:  :....|.||.:           :.|.||:..|::.|..:..||  ....|||.|||||.:
  Fly    76 HCIVDQDVQSVSLGAY-----------NKSDPADRKDVITAVVHSSFDVRASYENDIGLLKLSSD 129

  Fly   146 IRFNVHIQPICLILNPAAA---PNVHEFQAFGWGQTETNHSANVLQTTVLTRYDNRHCRSVLSMP 207
            :.||..|:|||::||.:.|   .|:..|:|||||....|.::::|||.:|...|...|...||:.
  Fly   130 VIFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREECYMELSVY 194

  Fly   208 ITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVW-RYLQLGIVSFGDDKCQSPGVYTYVPNYIRW 271
            .:..|:|.|....|||.|||||||...|...|:. |.:|.||:|.|...|...||||.:.::..|
  Fly   195 PSEKQICAGVPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDGQGVYTDLMSFADW 259

  Fly   272 IRYVMQ 277
            |:..::
  Fly   260 IKMTIE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 86/235 (37%)
Tryp_SPc 45..273 CDD:238113 87/235 (37%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 86/235 (37%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.