DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG30091

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:266 Identity:88/266 - (33%)
Similarity:134/266 - (50%) Gaps:21/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCM-- 87
            :|..|...|||..:  :..:||.|.:|.....|:||.:..:.|..|||::|:::::|||||||  
  Fly    19 SARLLDEDCGVPMQ--LIPKIVGGVDAGELKNPWMALIKTNDEFICGGSVITNKFVLTAAHCMCT 81

  Fly    88 -------RPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD-RFLANDIALLKLSR 144
                   ...|.|.||.:.:...     |..:.|.|.:::.....:..|. :...||||||:|.:
  Fly    82 DEECIVKYTQLTVTLGVYHLLAT-----GEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQK 141

  Fly   145 NIRFNVHIQPICLILNPAAAPN---VHEFQAFGWGQTETNHSANVLQTTVLTRYDNRHCRSVLSM 206
            :|.:...|:|:|::||....|.   :.||.|.|||.|.....:|.||...:.|.|.:.|.:....
  Fly   142 SIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWY 206

  Fly   207 PITINQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQSPGVYTYVPNYIR 270
            .......|.|.. |.|||..||||||...:.:||:.|..||||||.|.:.|:..|:||.|..:|.
  Fly   207 TFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFGMYTDVMGHID 271

  Fly   271 WIRYVM 276
            :|..::
  Fly   272 FIERIV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 82/241 (34%)
Tryp_SPc 45..273 CDD:238113 82/241 (34%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 82/241 (34%)
Tryp_SPc 37..276 CDD:238113 83/243 (34%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463348
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.640

Return to query results.
Submit another query.