DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG30087

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:277 Identity:151/277 - (54%)
Similarity:204/277 - (73%) Gaps:2/277 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LASTSIYICMCVCLVLQEQVA-ANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEI 68
            :.::..:..:.:||:.|:::. |.||.|.|||:|||..|.|:|.||||:::|||||.|:..:|..
  Fly     1 MKTSPAWFVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLT 65

  Fly    69 HCGGTIISSRYILTAAHCMRPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRF- 132
            ||||:|::||||||||||:.|.|::|||||:|..:|||||.:|||.:||:.|:.|..::.::.. 
  Fly    66 HCGGSILNSRYILTAAHCVFPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAAN 130

  Fly   133 LANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQTETNHSANVLQTTVLTRYDN 197
            ..||||||||:|:|.|||||||||::||||:||:|..:|.||||:|:.|...::|||..|..||.
  Fly   131 HVNDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDA 195

  Fly   198 RHCRSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQSPGVY 262
            .:|.......:..||:|.|.:..|||:|||||||||:|::|||.|||||||||:|...|||||||
  Fly   196 AYCSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVY 260

  Fly   263 TYVPNYIRWIRYVMQSN 279
            |||||||.|||..|..|
  Fly   261 TYVPNYINWIRRAMLIN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 132/228 (58%)
Tryp_SPc 45..273 CDD:238113 132/228 (58%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 132/228 (58%)
Tryp_SPc 42..272 CDD:238113 133/229 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463252
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.790

Return to query results.
Submit another query.