DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and Tmprss11a

DIOPT Version :10

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_006534903.1 Gene:Tmprss11a / 194597 MGIID:2684853 Length:392 Species:Mus musculus


Alignment Length:50 Identity:13/50 - (26%)
Similarity:26/50 - (52%) Gaps:3/50 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 FTLLLLARHPEVQERVYREVVAIVGNDPATPATHRNL---QDMKYLELVI 370
            |:.|||.....:.:.::||::..:|...|..|.:|.|   :..:|.|.::
Mouse    17 FSQLLLLWRGSIYKLLWRELLCFLGLYMALSAAYRFLLAEEQKRYFEKLV 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 45..273 CDD:238113
Tmprss11aXP_006534903.1 SEA 42..135 CDD:460188 6/24 (25%)
Tryp_SPc 161..389 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.