DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG43336

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:255 Identity:85/255 - (33%)
Similarity:140/255 - (54%) Gaps:8/255 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYS-SEIHCGGTIISSRYILTAAHCM- 87
            :..||..:||:...|....|:..|..|.|.|:|:||:|:.: ....|||::|::|.:||||||. 
  Fly    18 STQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLVLTAAHCFL 82

  Fly    88 -RPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRF-LANDIALLKLSRNIRFNV 150
             |..|..||||:|......|....|:...|.. :....:::.::.. :|.|||:|:|.|.:::..
  Fly    83 DRTELVARLGEYDREEYEMCHDSYCTYRIEAM-VERGFRHRHYNPMTMAYDIAILRLYRKVQYTD 146

  Fly   151 HIQPICLILNPAAAPNVHEFQAF---GWGQTETNHSANVLQTTVLTRYDNRHCRSVLSMPITINQ 212
            :|:|||::::|.....:......   |||:||:...:..|:|..|.|.....||...::.:|.||
  Fly   147 NIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDLARKHPEVCRRYATLSLTANQ 211

  Fly   213 LCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQSPGVYTYVPNYIRWI 272
            .|.|.:.|:.|:||||||:...:.|....|::|:||.||.:.:|....|:|.|.:|:.||
  Fly   212 FCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQCVMVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 78/234 (33%)
Tryp_SPc 45..273 CDD:238113 79/235 (34%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 78/234 (33%)
Tryp_SPc 40..271 CDD:238113 77/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463316
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.690

Return to query results.
Submit another query.