DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and CG43110

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:274 Identity:91/274 - (33%)
Similarity:146/274 - (53%) Gaps:18/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TSIYICMCVCLVLQEQVA-ANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCG 71
            |.:::.:.:|.:...|:| :.||...||    .....:|:.|..|..:||.:||.::.::.:.||
  Fly     2 TYLFVWIFLCSLGSCQLAYSMFLKQPCG----KTPVPKIISGSNASQQSAQYMAGIFNTTHLLCG 62

  Fly    72 GTIISSRYILTAAHCMRPY-LKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRF-DRFLA 134
            ||||...::||.|||.... |.||||.::|..           |.::..::....:.:: :...|
  Fly    63 GTIIHEDFVLTVAHCKSTQTLFVRLGAYNINH-----------PTDQIRVIETIAHPQYSNSTYA 116

  Fly   135 NDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQTETNHSANVLQTTVLTRYDNRH 199
            |||||:||.|::.||::|||||:.|:......:..:.|||||:|.....:::||...:.|.:...
  Fly   117 NDIALVKLERSVIFNLNIQPICIHLDATLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMI 181

  Fly   200 CRSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQSPGVYTY 264
            |...|.|.....|:|......|||:|||||||::|:.|.|.....|.||.|:|..:|...|:||.
  Fly   182 CHLYLGMSPDPKQICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTD 246

  Fly   265 VPNYIRWIRYVMQS 278
            |..|..||..:::|
  Fly   247 VSQYSGWIANIVRS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 80/229 (35%)
Tryp_SPc 45..273 CDD:238113 81/229 (35%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 80/229 (35%)
Tryp_SPc 36..257 CDD:238113 82/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463392
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.