DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:260 Identity:89/260 - (34%)
Similarity:119/260 - (45%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAAHCMRP-----YLK 92
            ||: ...|.:...|.|:.:.....|:.|.||:.|...|||::|:..::|:||||...     ||.
Zfish   297 CGI-IPVNSSNGTVGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHCFNGQRNGFYLT 360

  Fly    93 VRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFD-RFLANDIALLKLSRNIRFNVHIQPIC 156
            |.||       |..| ....|......:....|:..:: ....|||||::||..|.|...|:|:|
Zfish   361 VILG-------PKTQ-NKYDPSRISRSVKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSIRPVC 417

  Fly   157 LILNPAAAPNVHEFQAFGWGQTETN-------HSANVLQTTVLTRYDNRHCRSVLSM-PITINQL 213
            |    ||..:|.......|..|..|       .|..:.|...:....||.|..:..: .||.|.:
Zfish   418 L----AAEGSVFNSDTESWITTWRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNMI 478

  Fly   214 CVGF--QGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQS--PGVYTYVPNYIRWIRY 274
            |.|.  :|.|.|.||||||:|:  |...||  :|.||||||....||  |||||.|..|..||.|
Zfish   479 CAGLLKEGKDLCQGDSGGPMVS--NQSSVW--VQSGIVSFGSGCAQSEFPGVYTRVSRYQEWITY 539

  Fly   275  274
            Zfish   540  539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 83/245 (34%)
Tryp_SPc 45..273 CDD:238113 84/245 (34%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 83/243 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.