DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30088 and zgc:163079

DIOPT Version :9

Sequence 1:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:286 Identity:87/286 - (30%)
Similarity:126/286 - (44%) Gaps:51/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VAANFLIPSCGVSYESNVA------TRIVRGKEAMLKSAPFMA--YLYYSSEIHCGGTIISSRYI 80
            ||...|:...|...:|:|.      |:|:.|..|...|.|:.|  .|..:.|.:|||::|:..::
Zfish     9 VAGAILLNIAGCLGQSDVCGRAPLNTKIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWV 73

  Fly    81 LTAA--HCMRPY--LKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLK 141
            ||.|  ..:.|.  :.|.||.       ..|.|| :|......:....|:..::. |.:::||||
Zfish    74 LTTAKVFALMPASDIVVYLGR-------QTQNGS-NPYEISRTVTKIIKHPNYNS-LDSNLALLK 129

  Fly   142 LSRNIRFNVHIQPICLILNPAAAPNVH----EFQAFGWGQTETNHSA--------NVLQTTVLTR 194
            ||..:.|:.:|:|:||    |||.:|.    .....|||.  .|..|        :|||......
Zfish   130 LSSPVTFSDYIKPVCL----AAAGSVFVDGTASWVTGWGY--LNRPATVEEIMLPDVLQEVEAPI 188

  Fly   195 YDNRHCRSVLSMPITINQLCVGF---QGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKC 256
            .:|..|.:.....||...||.|:   .|...|:||.|||||.|  ...:|  :|.|:|..|  .|
Zfish   189 VNNFECNAAYGGIITNKLLCAGYLNEDGKAPCAGDVGGPLVIK--QGAIW--IQSGVVVSG--YC 247

  Fly   257 QSPG---VYTYVPNYIRWIRYVMQSN 279
            ..||   :|..|..|..||.|...|:
Zfish   248 GLPGYPTIYVRVSEYEDWISYYTNSS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 76/251 (30%)
Tryp_SPc 45..273 CDD:238113 77/251 (31%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 76/251 (30%)
Tryp_SPc 36..267 CDD:238113 77/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.