DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG34409

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:299 Identity:90/299 - (30%)
Similarity:129/299 - (43%) Gaps:89/299 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CGVTYESQTAMRVVNGKEAVIRSAPFMVYVT--NNSLT----HCGGSILNSRYILTAAHCVFPNL 88
            ||:..||    |::.|.:|.....|::..:.  |.|.:    .|.||:::|.:|:||||||. ||
  Fly   242 CGINVES----RLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVV-NL 301

  Fly    89 -------RLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINF 146
                   .:|||..:..|              .:.|.:.|.|..|:...:.||||||::|.:   
  Fly   302 VSDLELSHVRLGSQDGAT--------------PFAIEQVIVHPNYDQPKYANDIALLRINST--- 349

  Fly   147 NVHIQPICILLNPASAP-----------SVATYQTFGW--GETKKNG---------------FPH 183
            |....|||:   |.:.|           .||.    ||  |.|:.|.               .|.
  Fly   350 NGTFTPICL---PFNGPITLGNRLIGQIGVAA----GWSIGSTENNSSMDPSNSTAGVRFIRLPI 407

  Fly   184 LLQTAELRAYDAAYCSRSFH--AYMNGNQICA-GHEERDTCAGDSGGPLVTRVDFDGVK------ 239
            :..|:...||  |..|.:|.  ..:..|.:|| |....|.|.||||||.:.    ||..      
  Fly   408 VNTTSCAIAY--ASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMD----DGTSGVFGTS 466

  Fly   240 -RYLQLGIVSYGPTDC---QSPGVYTYVPNYINWIRRAM 274
             ||..:|||::|||.|   ..|||||.|.::.:||.|::
  Fly   467 GRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWILRSI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 83/282 (29%)
Tryp_SPc 42..272 CDD:238113 84/283 (30%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 83/282 (29%)
Tryp_SPc 252..501 CDD:238113 82/279 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.