DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and PLG

DIOPT Version :10

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_000292.1 Gene:PLG / 5340 HGNCID:9071 Length:810 Species:Homo sapiens


Alignment Length:64 Identity:20/64 - (31%)
Similarity:28/64 - (43%) Gaps:14/64 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 EVRYFLLPFLVMRL---LRKGGTARGALALEL----VINVAMNIATFALFFHKEIV-----WKN 425
            ||.|  |...|.||   |::..|.:|.|.|:|    ..:||:......|...||::     |.|
Human   211 EVEY--LTEDVKRLNEKLKESNTTKGELQLKLDELQASDVAVKYREKRLEQEKELLHNQNSWLN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 42..272 CDD:238113
PLGNP_000292.1 PAN_AP_HGF <38..97 CDD:238532
KR 101..183 CDD:214527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..145
KR 183..263 CDD:214527 17/53 (32%)
KR 273..354 CDD:214527 20/64 (31%)
KR 375..456 CDD:214527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 396..416
KR 479..560 CDD:214527
Tryp_SPc 581..804 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.