DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and PLAT

DIOPT Version :10

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_000921.1 Gene:PLAT / 5327 HGNCID:9051 Length:562 Species:Homo sapiens


Alignment Length:41 Identity:8/41 - (19%)
Similarity:19/41 - (46%) Gaps:11/41 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 IDLLVARGSVSQTL------LSPRM-----LFHTVADILDR 214
            :|.::.:..|:...      :||::     :.|.|..:||:
Human    65 VDSMLDKSEVNNPAIGKDENISPQVKGDEDMGHEVGSMLDK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 42..272 CDD:238113 8/41 (20%)
PLATNP_000921.1 FN1 41..83 CDD:214494 2/17 (12%)
Important for binding to annexin A2 42..52
EGF 86..117 CDD:394967 6/20 (30%)
KR 125..209 CDD:238056
Kringle 215..296 CDD:395005
Tryp_SPc 313..559 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.