DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:253 Identity:76/253 - (30%)
Similarity:115/253 - (45%) Gaps:51/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVVNGKEAVIRSAPFMV--YVTNNSLTHCGGSILNSRYILTAAHCV--FPNLRLRLGEHNIRTDP 101
            |:.||..|.....|::|  ..:.|....|||||:.:.::||||||.  ...:.:..|. ::|..|
  Fly    37 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA-SLRNQP 100

  Fly   102 DCQGSNCSPRSEEY----GIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPASA 162
                        :|    |....:.|..||:.|..|||:|::       ..|:. ...|:|....
  Fly   101 ------------QYTHWVGSGNFVQHHHYNSGNLHNDISLIR-------TPHVD-FWHLVNKVEL 145

  Fly   163 PSV-ATYQTF--------GWGETKKNG-FPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAG-HE 216
            ||. ..||.:        |||.|.... .|..||..:::....:.||||:.  ::.|.||.. :.
  Fly   146 PSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRSWS--LHDNMICINTNG 208

  Fly   217 ERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSY-GPTDCQS--PGVYTYVPNYINWIR 271
            .:.||.|||||||||.   :|.:   .:|:.|: ....|||  |.|::.|..|::|||
  Fly   209 GKSTCGGDSGGPLVTH---EGNR---LVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 73/250 (29%)
Tryp_SPc 42..272 CDD:238113 75/252 (30%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 73/250 (29%)
Tryp_SPc 38..262 CDD:238113 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436007
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.