DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG11843

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:311 Identity:92/311 - (29%)
Similarity:137/311 - (44%) Gaps:60/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PAWFVIAIC-----LIRQQRIVDAQFLNPLCGVTYESQ--------TAMRVVNGKEAVIRSAPFM 56
            |...|:..|     .:.::|| :..||.|  |.:.||:        |.: :|.|..|..|..|.|
  Fly    22 PDMDVVGSCSRYKKSVFEERI-EFGFLLP--GASIESRIIDNCRSYTPL-IVGGHPAQPREFPHM 82

  Fly    57 VYV------TNNSLTHCGGSILNSRYILTAAHCVFPNLRLRLGEHNI----RTDPDCQGSNCSPR 111
            ..:      ::.:...|||.:::.|::||||||    |....||.|:    ..|.|....:.:||
  Fly    83 ARLGRRPDPSSRADWFCGGVLISERFVLTAAHC----LESERGEVNVVRLGELDFDSLDEDAAPR 143

  Fly   112 SEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGET 176
              :|.:...|.|..|......:||.|:||..::.|:::..|.|:...  ...|..::...|||.|
  Fly   144 --DYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQ--DERSSDSFIAVGWGST 204

  Fly   177 KKNGFPHL-LQTAELRAYDAAYC----SRSFHAYMNG----NQICAGHE-ERDTCAGDSGGPLVT 231
            .....|.. |...:|:.|....|    :|....:..|    ||:|.|.| .:|||.|||||||:.
  Fly   205 GLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLM 269

  Fly   232 RVDFDGVKR-----YLQLGIVSYGPTDCQS---PGVYTYVPNYINWIRRAM 274
                  ..|     |:.:||.|.| ..|.|   ||:||.|..|:.||.|.:
  Fly   270 ------YHREYPCMYVVVGITSAG-LSCGSPGIPGIYTRVYPYLGWIARTL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 77/256 (30%)
Tryp_SPc 42..272 CDD:238113 79/257 (31%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 79/258 (31%)
Tryp_SPc 68..309 CDD:214473 77/255 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.