DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG11841

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:291 Identity:86/291 - (29%)
Similarity:137/291 - (47%) Gaps:52/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIRQQRIVDAQFLNPLCGVTYESQTAMR-----VVNGKEAVIRSAPFMVYV----TNNSLT-HCG 68
            ::.::|:..:.|... ..:|||:..:..     :|:|..|..:..||...:    |||.:. .||
  Fly    40 IVFEERVAISFFFTD-APITYETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCG 103

  Fly    69 GSILNSRYILTAAHCVFP-----NLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNA 128
            |:::::|.:||||||.|.     |: :||||....||.|    :..|  |::|::....|..:..
  Fly   104 GTLISNRLVLTAAHCFFSEHGEVNV-VRLGELEFDTDTD----DAEP--EDFGVLALKAHPGFEN 161

  Fly   129 ANHVNDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWG-------ETKKNGFPHLLQ 186
            ....|||.:::|:|.:.||.:..|.|:..:......  ::...|||       |:||      |.
  Fly   162 PQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQHE--SFIAIGWGQKKFAQKESKK------LL 218

  Fly   187 TAELRAYDAAYCSRSFHA-------YMNGNQICAG-HEERDTCAGDSGGPLVTRVDFDGVKRYLQ 243
            ..:|:.|... |..|..|       |...:|:|.| .:.:|||.|||||| |.....|....|..
  Fly   219 KVQLQGYKDR-CVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGP-VLAYHKDLACMYHV 281

  Fly   244 LGIVSYGPTDCQSPGV---YTYVPNYINWIR 271
            :||.|.|.| |.:|.:   ||.|..::|||:
  Fly   282 MGITSAGIT-CSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 79/261 (30%)
Tryp_SPc 42..272 CDD:238113 81/258 (31%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 80/256 (31%)
Tryp_SPc 72..310 CDD:214473 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.