DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and SPE

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:280 Identity:89/280 - (31%)
Similarity:139/280 - (49%) Gaps:37/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSL------THCGGSILNSRYILTAAHCVF 85
            |.:||..:    |.|:..|....:...|:||.:....|      .:|||::|||||:|||.||:.
  Fly   124 NDVCGFLF----ADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLA 184

  Fly    86 PN---------LRLRLGEHNIRTDPDC----QGSN-CSPRSEEYGIMKAITHRFY--NAANHVND 134
            ..         ..:||||.:.||||||    .|.. |:|:..:..:.|.|.|..|  |:.:..||
  Fly   185 SRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRND 249

  Fly   135 IALLKLNRSINFNVHIQPICILLNPASAPSVATY--QTFGWGETKKNGFPHLLQ-TAELRAYDAA 196
            |||::|.|.:::..:::|||:..:.....:...|  ...|||.| :|..|..:: ...:..::..
  Fly   250 IALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLT-ENMQPSAIKLKITVNVWNLT 313

  Fly   197 YCSR---SFHAYMNGNQICAGHE-ERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQS- 256
            .|..   ||...::.:|:|||.: ..|||.|||||||:..:...|...:...|:.|||...|.. 
  Fly   314 SCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLK 378

  Fly   257 --PGVYTYVPNYINWIRRAM 274
              |||||....:|:||::.:
  Fly   379 GWPGVYTRTGAFIDWIKQKL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 83/260 (32%)
Tryp_SPc 42..272 CDD:238113 84/261 (32%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 84/262 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463595
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.