DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG16710

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:298 Identity:97/298 - (32%)
Similarity:144/298 - (48%) Gaps:38/298 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IAICLIRQQRIV-DAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYV----------TNNS 63
            :.||......|: :.|...|:       ..|.|:..|:|......|:|..:          ....
  Fly    80 VLICCPNMGHILPNTQICGPI-------MPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERL 137

  Fly    64 LTHCGGSILNSRYILTAAHCV----FPNLRLRLGEHNIRTDPDC----QG-SNCSPRSEEYGIMK 119
            ::.|.||::.:||:||||||:    ....|:|||||||.::|||    .| .:|:|...|..:..
  Fly   138 VSRCAGSLITNRYVLTAAHCLRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDL 202

  Fly   120 AITHRFYNAANH--VNDIALLKLNRSINFNVHIQPICILLNPA-SAPSVATY--QTFGWGETKKN 179
            :|.||.|.....  .||||||:|...:.:...|:|||:.|:.. |.||.:.:  |..|||.:.|.
  Fly   203 SIKHRHYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQ 267

  Fly   180 GFPHLLQTAELRAYDAAYCSRSFHA--YMNGNQICAGH-EERDTCAGDSGGPLVTRVDFDGVKRY 241
            |:.::|..|.:...:|..||.|..:  ......||||: ...|||.|||||||:..:: .|.:.:
  Fly   268 GYSNVLLQAYVNGRNADECSLSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIME-RGDEEF 331

  Fly   242 LQL-GIVSYGPTDC-QSPGVYTYVPNYINWIRRAMLIN 277
            :.| ||.|||.:.| ..|..||....::.||...|..|
  Fly   332 VYLAGITSYGYSQCGYGPAAYTKTSKFVEWILWNMYTN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 87/257 (34%)
Tryp_SPc 42..272 CDD:238113 88/258 (34%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 1/3 (33%)
Tryp_SPc 105..362 CDD:214473 87/257 (34%)
Tryp_SPc 106..362 CDD:238113 86/256 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463600
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.