DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG31219

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:274 Identity:98/274 - (35%)
Similarity:147/274 - (53%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LCGVTYESQTAMRVVNGKEAVIRSAPFM---VYVTNNS---LTHCGGSILNSRYILTAAHCV--F 85
            :||   :|.:..|:|.|.||.....|:|   :|:...:   |..|.||::|:||:||:||||  .
  Fly    79 ICG---QSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGI 140

  Fly    86 P---NLR-LRLGEHNIRTD----PDC--QGSNCSPRSEEYGIMKAITHRFYNAANHVN---DIAL 137
            |   :|: :|||||:|..|    |||  |.:.|:..:.|..:.|.|.|..:::.::.|   ||||
  Fly   141 PRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIAL 205

  Fly   138 LKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAYCSRSF 202
            |:|...:.:...|.||||..:...|.|  ..:..|||:|.:..|..:|....:|....|.|:..|
  Fly   206 LRLKMPVRYRTGIMPICIPKHGFFAKS--KLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRF 268

  Fly   203 HAYMNGN---QICA-GHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQS---PGVY 260
             .|::.|   |||| |::..|||.|||||||:..:|...|  || .||.:||..:|..   ||:|
  Fly   269 -PYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSV--YL-AGITTYGSKNCGQIGIPGIY 329

  Fly   261 TYVPNYINWIRRAM 274
            |....::.||:..:
  Fly   330 TRTSAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 93/256 (36%)
Tryp_SPc 42..272 CDD:238113 94/257 (37%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 93/256 (36%)
Tryp_SPc 90..342 CDD:238113 94/257 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.