DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG5255

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:255 Identity:76/255 - (29%)
Similarity:112/255 - (43%) Gaps:38/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VTYESQ-TAMRVVNGKEAVIRSAPFMVYVTN-NSLTH-CGGSILNSRYILTAAHCV----FPNLR 89
            :.|..| |..|:|.|:||....||:.:.:.. .|..| |||:|::.|:|:|||||.    ....|
  Fly    19 ILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFR 83

  Fly    90 LRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPIC 154
            :..|..::..:          .|:.|...:.:.|..|....:.||||||.||.||.|:...||: 
  Fly    84 VLTGTQDLHQN----------GSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPV- 137

  Fly   155 ILLNPASAPSVATYQTFGWGETKKNG-FPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAGH--- 215
            .|.:.|..|......| |||.....| .|..||:.|:.......|..   |:.|..::..||   
  Fly   138 ELDHEALVPGSRLLLT-GWGTLSLGGDVPARLQSLEVNYVPFEQCRA---AHDNSTRVDIGHVCT 198

  Fly   216 ---EERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYG-PTDCQSPGVYTYVPNYINWIR 271
               :.|..|.||||||||.....        :.:|::| |.....|..:..:..|.::||
  Fly   199 FNDKGRGACHGDSGGPLVHNGKL--------VALVNWGLPCAKGYPDAHASISYYHDFIR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 71/242 (29%)
Tryp_SPc 42..272 CDD:238113 72/244 (30%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 71/242 (29%)
Tryp_SPc 30..252 CDD:238113 72/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437330
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.