DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG17477

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:250 Identity:72/250 - (28%)
Similarity:110/250 - (44%) Gaps:42/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VVNGKEAVIRSAPFMVYVTNNSLTH-CGGSILNSRYILTAAHCV--FPNLRLRLGEHNIRTD--- 100
            :|.|:.|....||:.|.:.....:| |||:|::.|:|:||.|||  :|..||::....||..   
  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG 91

  Fly   101 ----PDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPAS 161
                ||....:|:                |::..:.|||.||.||.||.||...|.:.:..:|  
  Fly    92 AVYYPDAIYLHCN----------------YDSPKYQNDIGLLHLNESITFNALTQAVELPTSP-- 138

  Fly   162 APSVATYQTF-GWGETKKNG-FPHLLQTAELRAYDAAYCSRSFHAY----MNGNQICAGHEER-D 219
            .|..|:...| |||.....| .|..||..:.:..::..|.....||    :....|||..:.. .
  Fly   139 FPRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIG 203

  Fly   220 TCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWIRRAM 274
            .|.||||||||.:....|:..:       :.|.....|.::..:..|.:|:|:.|
  Fly   204 ACHGDSGGPLVHQGTLVGILNF-------FVPCAQGVPDIFMNIMYYRDWMRQTM 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 69/244 (28%)
Tryp_SPc 42..272 CDD:238113 70/246 (28%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 71/247 (29%)
Tryp_SPc 27..246 CDD:214473 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.