DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG31326

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:287 Identity:71/287 - (24%)
Similarity:118/287 - (41%) Gaps:44/287 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIRQQRIVDAQFLNPL-----CGVTYESQTAMRVVNGKEAVIRSAPFMVYV-----TNNSLTHCG 68
            |:.||        ||.     ||....|.|.: :..||.......|::|.:     :|.....||
  Fly   250 LVPQQ--------NPSSNGIPCGRERASTTPL-IFQGKSLQRGQLPWLVAIFERRESNGPAFICG 305

  Fly    69 GSILNSRYILTAAHCV------FPNLRL--RLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRF 125
            |:::::..:|:||||.      .|..||  .||.:.:....|         .|..|:.:.|.|..
  Fly   306 GTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSD---------GEFRGVSQLIIHEN 361

  Fly   126 YNAANHVN-DIALLKLNRSINFNVHIQPICI--LLNPASAPSVATYQTFGWG-ETKKNGFPHLLQ 186
            :....... |:||::|:..:.:..:|.|||:  ..|....|........||| :....|...:.:
  Fly   362 FQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSK 426

  Fly   187 TAELRAYDAAYCSRSF-HAYMNGNQICAGHEERDTCAGDSGGPLVTR-VDFDGVKRYLQLGIVSY 249
            ..:|.....|.|:... |..:..:.:||.......||.|.||||:.| .|...::..:..|:::.
  Fly   427 VTDLNIVSEANCALELPHVLVQPSSLCAKKTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINE 491

  Fly   250 GPTDCQ--SPGVYTYVPNYINWIRRAM 274
            ....|:  .|.|:|.|..:|.|:|:.|
  Fly   492 KENTCELSKPSVFTDVAKHIEWVRQKM 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 59/249 (24%)
Tryp_SPc 42..272 CDD:238113 60/250 (24%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 61/248 (25%)
Tryp_SPc 277..514 CDD:214473 59/245 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.