DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG9649

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:280 Identity:72/280 - (25%)
Similarity:120/280 - (42%) Gaps:50/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LNPLCGVTYESQTAMRVVNGKEAVIRSAPFMV----YVTNNSLTHCGGSILNSRYILTAAHCVFP 86
            |:.:||.....||.. :.||.|......|:|.    :|..:....|||:::::|.:::||||   
  Fly   242 LSGICGREKVIQTPF-IHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHC--- 302

  Fly    87 NLRLRLGEHNI----------RTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVN-DIALLKL 140
               .|.|..|:          |...|...|..:     .|:.:.:.|..||...:.: |:|||:|
  Fly   303 ---FRFGSRNLPGERTIVSLGRNSLDLFSSGAT-----LGVARLLIHEQYNPNVYTDADLALLQL 359

  Fly   141 NRSINFNVHIQPICI-----LLNPASAPSVATYQTFGWGETKK-NGFPHLLQTAELRAYDAAYC- 198
            :..::...:|:|||:     ||   ..||.......||||.:| |....|.:..:........| 
  Fly   360 SNHVDIGDYIKPICLWNENFLL---ELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECR 421

  Fly   199 ---SRSFHAYMNGNQICAGHEERD-TCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGP-----TDC 254
               |.....::..:.|||.:.:.. .|:|||||.|:.:..    ..::..|:||.|.     .:.
  Fly   422 GNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQ----DIWMLRGVVSAGQRMTNRCNL 482

  Fly   255 QSPGVYTYVPNYINWIRRAM 274
            ..|.:||.|..:|.|:..:|
  Fly   483 TLPVIYTDVAKHIEWLLSSM 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 65/259 (25%)
Tryp_SPc 42..272 CDD:238113 66/260 (25%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 65/258 (25%)
Tryp_SPc 259..497 CDD:214473 65/255 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.