DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG8870

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:283 Identity:90/283 - (31%)
Similarity:133/283 - (46%) Gaps:43/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NPLCGVTYES--------QTAMRVVNGKEAVIRSAPFM---VYVTNNSLTH-----CGGSILNSR 75
            |.:|...:|:        |:..:...||...:...|:|   :|...|:|:.     ||||::|:.
  Fly    61 NKVCCPKWETYLPHDTCGQSRRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNW 125

  Fly    76 YILTAAHCV-FPNL-------RLRLGEHNIRTDPDCQGSN----CSPRSEEYGIMKAITHRFYNA 128
            |:||||||| :|.:       .:||||||..|:||....|    .:|...|..:.:.|||..:|.
  Fly   126 YVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNR 190

  Fly   129 ANH-VNDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTAELRA 192
            ... :|||||::|...:.:...|||||:......|.....:|..||.:..:.....:|    ||:
  Fly   191 GRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQGIASEVL----LRS 251

  Fly   193 YDAA----YCSRSFHAYMNGNQICAGH-EERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPT 252
            :.|.    .| :|.:.:..|:|||||. :..||..|||||||:..|....|......||:|||..
  Fly   252 FIAERHPDVC-KSNYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQK 315

  Fly   253 DCQ----SPGVYTYVPNYINWIR 271
            .|.    .|..||....:..||:
  Fly   316 PCVLKTCKPAFYTKTSYFFEWIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 84/258 (33%)
Tryp_SPc 42..272 CDD:238113 86/260 (33%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 84/251 (33%)
Tryp_SPc 93..337 CDD:214473 82/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.