DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and snk

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:273 Identity:77/273 - (28%)
Similarity:124/273 - (45%) Gaps:56/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVVNGKEAVIRSAPFMVYVT---NNSLTH--------------------CGGSILNSRYILTAAH 82
            |..:||:.| .|.|.:|..|   :....|                    |||::::..|:|||||
  Fly   172 RTFSGKQCV-PSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAH 235

  Fly    83 CVF----PNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRS 143
            |..    |...:|||...:        :..|...::..|:..:.|..|.::.:.:|||||||.|.
  Fly   236 CATSGSKPPDMVRLGARQL--------NETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRR 292

  Fly   144 INFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGF-PHLLQTAELRAYDAAYCSRSF----- 202
            :.|:..::|.|:...|..  .:.|....|||.|:..|. .:.|:..:|.......|.:.:     
  Fly   293 VKFSEQVRPACLWQLPEL--QIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERR 355

  Fly   203 --HAYMNGNQICAGH--EERDTCAGDSGGPLVTRV-DFDGVKRYLQLGIVSYGPTDC---QSPGV 259
              ...:.| |.|||:  ..||||.||||||:...: :::.|.  ..:||.|:|.. |   .:|||
  Fly   356 LPRGIIEG-QFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVA--FVVGITSFGKF-CAAPNAPGV 416

  Fly   260 YTYVPNYINWIRR 272
            ||.:.:|::||.:
  Fly   417 YTRLYSYLDWIEK 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 75/269 (28%)
Tryp_SPc 42..272 CDD:238113 76/270 (28%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 71/258 (28%)
Tryp_SPc 186..427 CDD:214473 69/254 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.