DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG13318

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:239 Identity:69/239 - (28%)
Similarity:107/239 - (44%) Gaps:53/239 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GGSILNSRYILTAAHCVFPNL-----RLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYN 127
            ||:::.::::|||||.|: ||     ::||||.:..:.     |...|..:.| |.....:..:|
  Fly   190 GGALITAQHVLTAAHKVY-NLGLTYFKVRLGEWDAAST-----SEPIPAQDVY-ISNVYVNPSFN 247

  Fly   128 AANHVNDIALLKLNR--SINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTAEL 190
            ..|..||:|:|||:.  |:.....:..:|:   |.::.........|||   ||.|      ...
  Fly   248 PNNLQNDVAILKLSTPVSLTSKSTVGTVCL---PTTSFVGQRCWVAGWG---KNDF------GAT 300

  Fly   191 RAYDA------------AYCSRSFHAYMNGNQ--------ICAGHEE-RDTCAGDSGGPLVTRVD 234
            .||.|            |.|..:..|...|:.        ||||.|. :|.|.||.|.|||  ..
  Fly   301 GAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLV--CT 363

  Fly   235 FDGVKRYLQLGIVSYGPTDCQS--PGVYTYVPNYINWIRRAMLI 276
            .:||  :..:|:|::|....|:  ||||..|..|:.||:..:.:
  Fly   364 SNGV--WYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWIQTTLTL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 67/231 (29%)
Tryp_SPc 42..272 CDD:238113 69/233 (30%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 69/234 (29%)
Tryp_SPc 169..399 CDD:214473 67/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.