DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and MP1

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:278 Identity:99/278 - (35%)
Similarity:139/278 - (50%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVT-----NNSLTHCGGSILNSRYILTAAHCV--F 85
            |.||..:..    |||.|.|...|..|:|..:.     |....|||||::|.||:|||||||  .
  Fly   128 PNCGENFGD----RVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAI 188

  Fly    86 PN----LRLRLGEHNIRTDPDCQ-GSN----CSPRSEEYGIMKAITHRFY--NAANHVNDIALLK 139
            |:    ..:||||.:..|:|||. |.|    |:....:|.:.:.|.|..|  |:.:.:||||||:
  Fly   189 PSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLR 253

  Fly   140 LNRSINFNVHIQPICILLNPASAPSVATYQ----------TFGWGETKKNGFPHLLQTAELRAYD 194
            |...:.::..|.|:|:       |::|:..          ..|||.|:.|...::...|||....
  Fly   254 LRDEVQYSDFILPVCL-------PTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVP 311

  Fly   195 AAYCSRSF---HAYMNGNQICAGHEER-DTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQ 255
            .:.|::.:   ...:...|:|||..|. |:|.|||||||:.....:|...|...|:||||||.|.
  Fly   312 TSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCG 376

  Fly   256 S---PGVYTYVPNYINWI 270
            .   |||||.|..|:|||
  Fly   377 LKGWPGVYTRVEAYLNWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 94/263 (36%)
Tryp_SPc 42..272 CDD:238113 95/264 (36%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 94/263 (36%)
Tryp_SPc 138..397 CDD:238113 95/264 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463603
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.