DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG14088

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:271 Identity:73/271 - (26%)
Similarity:116/271 - (42%) Gaps:59/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCG-----GSILNSRYILTAAH 82
            ||||..:||   |.:..:            :|.:|......|.|.|     |::::.|:|||..|
  Fly    24 AQFLGNICG---ERRDGL------------SPDIVGPWTAILHHFGRIVGVGTLIHERFILTDVH 73

  Fly    83 C--VFPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSIN 145
            |  ....:|.||||:         |...|..:|::.:....::..:|.....|::.|:||.|::.
  Fly    74 CGDSIGVIRARLGEY---------GRIGSELAEDHIVAAFFSNANFNPETQANNMGLMKLLRTVV 129

  Fly   146 FNVHIQPICILLNPASAPSVATYQTFG----------WGETKKNGFPHLLQTAELRAYDAAYCSR 200
            :..||.|:|||::       :..|||.          |..:.|:  |.|.....:|...|  |.:
  Fly   130 YKEHIIPVCILMD-------SRMQTFADELDYFNGTTWKNSDKS--PMLRSKTVIRMPQA--CGK 183

  Fly   201 SFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPN 265
            ..|     .|.||||::.|:|...||..|...:|:.|..|.:..||.:.....|.:...||.|..
  Fly   184 LDH-----GQFCAGHKDLDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEVKCSNSRTYTDVVQ 243

  Fly   266 YINWIRRAMLI 276
            ...||  :|:|
  Fly   244 LHQWI--SMVI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 62/245 (25%)
Tryp_SPc 42..272 CDD:238113 64/246 (26%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 63/235 (27%)
Tryp_SPc 42..248 CDD:214473 61/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.