DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG7542

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:252 Identity:71/252 - (28%)
Similarity:114/252 - (45%) Gaps:41/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VVNGKEAVIRSAPFMVYVT---NNSLTHCGGSILNSRYILTAAHCV--FPNLRLRLGEHNIRTDP 101
            :.||:.|.:...|:...:.   .|..|.|||::::..:|:|||||:  ..::.:.||..||    
  Fly    27 ITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINI---- 87

  Fly   102 DCQGSNCSPRSEEYGIMKA--ITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPASAP- 163
               |.......|...:.|:  |.|..|.|:..||||:|::|...:.|...|:       .||.| 
  Fly    88 ---GDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIR-------AASLPR 142

  Fly   164 ----SVATYQTF-----GWGETK--KNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAGHEE 217
                ...||::.     |||...  .:....:|:..|:.....:.|...:...::...||.....
  Fly   143 RLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMSTTS 207

  Fly   218 -RDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPT-DCQ--SPGVYTYVPNYINWI 270
             :.||.||||||||.:   .|...|| :|..|:|.: .||  .|.|:|.:.:|::||
  Fly   208 GKSTCHGDSGGPLVYK---QGNSSYL-IGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 69/250 (28%)
Tryp_SPc 42..272 CDD:238113 71/252 (28%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 71/252 (28%)
Tryp_SPc 27..260 CDD:214473 69/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.