DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG18180

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:255 Identity:67/255 - (26%)
Similarity:110/255 - (43%) Gaps:56/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVVNGKEAVIRSAPFMVYV-----TNNSLTHCGGSILNSRYILTAAHCVFPN-LRLRLGEHNIRT 99
            |:|||..|....||::|.:     .:||.....|:|:.:.:|||||||:..: :.:..|.:    
  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGSN---- 95

  Fly   100 DPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVN-------DIALLKLNRSINFNVHIQPICILL 157
                .|.|.:.|.         |.|..|..:|.:       ||.|:: ...::||.       |:
  Fly    96 ----WGWNGAYRQ---------TVRRDNFISHPDWPSQGGRDIGLIR-TPHVDFNG-------LI 139

  Fly   158 NPASAPSV----ATYQ-----TFGWGETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQICA 213
            |....||:    ..||     ..|||..........||..:::....:.|.:::.: :....:|.
  Fly   140 NKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQAYGS-VASTDMCT 203

  Fly   214 GHEE-RDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDC-QSPGVYTYVPNYINWIR 271
            .|.: :..|.|||||||||.   |..:   .:|::::....| ..|..||.|.:|:.|||
  Fly   204 RHADGKSVCGGDSGGPLVTH---DNAR---LVGVITFASVSCHDGPSGYTRVSDYLEWIR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 64/252 (25%)
Tryp_SPc 42..272 CDD:238113 66/254 (26%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 64/252 (25%)
Tryp_SPc 36..259 CDD:238113 66/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.