DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG18179

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:272 Identity:70/272 - (25%)
Similarity:111/272 - (40%) Gaps:72/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VTYESQTAMRVVNGKEAVIRSAPFMVYVT-----NNSLTHCGGSILNSRYILTAAHCVFPN-LRL 90
            ||.......|:|||..|....||::|.:.     :||.....|:|:.|.:|||||||:..: :.:
  Fly    30 VTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEI 94

  Fly    91 RLGEH---------NIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVN-------DIALLK 139
            ..|.:         ::|.|                          |..:|.|       ||.|::
  Fly    95 HYGSNWGWNGAFRQSVRRD--------------------------NFISHPNWPAEGGRDIGLIR 133

  Fly   140 LNRSINFNVHIQPICILLNPASAPS--------VATY-QTFGWGETKKNGFPHLLQTAELRAYDA 195
             ..|:.|.       .|:|..:.||        |.|: ...|||..........||..:::....
  Fly   134 -TPSVGFT-------DLINKVALPSFSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISN 190

  Fly   196 AYCSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQS-PGV 259
            :.|.:|:....:.:......:.:.:|.|||||||||.   |..:   .:|::::|..||.| |..
  Fly   191 SECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPLVTH---DNAR---LVGVITFGSVDCHSGPSG 249

  Fly   260 YTYVPNYINWIR 271
            ||.|.:|:.|||
  Fly   250 YTRVTDYLGWIR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 65/260 (25%)
Tryp_SPc 42..272 CDD:238113 67/262 (26%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 65/260 (25%)
Tryp_SPc 40..263 CDD:238113 67/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.