DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG6592

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:268 Identity:74/268 - (27%)
Similarity:117/268 - (43%) Gaps:48/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHC 83
            ||......||.|   :..|..|.:...|                .|..||||:::.::::|||||
  Fly   122 RIFGGDVGNPHC---FPYQVGMLLQRPK----------------GLYWCGGSLISDKHVITAAHC 167

  Fly    84 VFPNLR--LRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINF 146
            |....|  :.||.:.|:...:.........||.:.|     :..:|.....:|||:::|..:::|
  Fly   168 VDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQI-----YPTWNPKRLKDDIAIVRLPHAVSF 227

  Fly   147 NVHIQPICILLNPASAPSVATYQTF--------GWGE--TKKNGFPHLLQTAELRAYDAAYCSRS 201
            |..|.||.:      ......|::|        |||.  |..:...::|:..:|:..|...|..:
  Fly   228 NERIHPIQL------PKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSN 286

  Fly   202 FHAYMNGNQIC-AGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGP---TDCQSPGVYTY 262
            |.....|..|| :|...|.||.||||||||.:....  |:.:.:||.|:|.   .|...|..:|.
  Fly   287 FPLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHS--KKRVLVGITSFGSIYGCDRGYPAAFTK 349

  Fly   263 VPNYINWI 270
            |.:|::||
  Fly   350 VASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 65/244 (27%)
Tryp_SPc 42..272 CDD:238113 67/245 (27%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 72/266 (27%)
Tryp_SPc 123..359 CDD:238113 73/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.