DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG10477

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:245 Identity:76/245 - (31%)
Similarity:115/245 - (46%) Gaps:32/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVVNGKEAVIRSAPFMVYVTNNSLT---HCGGSILNSRYILTAAHCV--FPNLRLRLGEHNIRTD 100
            |:.||.:|.....|:.|.::..|..   .|||||:.:.::||||||.  ..::.:..|. .:||.
  Fly    39 RITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGS-TVRTS 102

  Fly   101 PDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPASAPSV 165
                    :...::....|.:.|..||||...|||:|:| ..|:.|.|.|..|.:   ||.|.|.
  Fly   103 --------AKLKKKVSSSKFVQHAGYNAATLRNDISLIK-TPSVTFTVSINKIAL---PAIASSY 155

  Fly   166 ATY--QT---FGWGETKKNGFPHL--LQTAELRAYDAAYCSRSF-HAYMNGNQICA-GHEERDTC 221
            :||  ||   .|||.|..:.....  ||.|:.:....|.|.::| .:.:....||. ...::.||
  Fly   156 STYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTC 220

  Fly   222 AGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWIR 271
            .|||||||.......||..:     ||....:..:|..:|.|.:|::||:
  Fly   221 QGDSGGPLALNNRLIGVTSF-----VSSKGCEKNAPAGFTRVTSYLDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 74/242 (31%)
Tryp_SPc 42..272 CDD:238113 75/244 (31%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 74/242 (31%)
Tryp_SPc 40..267 CDD:238113 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.