DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG13527

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:244 Identity:74/244 - (30%)
Similarity:107/244 - (43%) Gaps:48/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHCVFPNLRLRL----------GEHNIRTDPDCQ 104
            |||.....|..:|.  :|||.:|::::::||||||....::..          ..|.:|..|.  
  Fly    47 IRSRTPNKYFGDNH--YCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPG-- 107

  Fly   105 GSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQP-ICILLNPASAPSVATY 168
            .|.|||.|..|.......|..:|       :||:||...:..|   .| |..|..|..||.:...
  Fly   108 KSVCSPVSSLYVPKNFTMHNTFN-------MALMKLQEKMPSN---DPRIGFLHLPKEAPKIGIR 162

  Fly   169 QT-FGWGETKKNGFP---HLLQTAELRAYDAAYCSRSFHAYMNGNQICAGHE----ERDTCAGDS 225
            .| .|||.....| |   |:.| .::...|.|.|...|..|.:| .:|||:.    :.:.|:||.
  Fly   163 HTVLGWGRMYFGG-PLAVHIYQ-VDVVLMDNAVCKTYFRHYGDG-MMCAGNNNWTIDAEPCSGDI 224

  Fly   226 GGPLVTRVDFDGVKRYLQLGIVSYGPTDC---QSPGVYTYVPNYINWIR 271
            |.||::        ..:.:|||:| |..|   ..|.|||.|.:.:.|||
  Fly   225 GSPLLS--------GKVVVGIVAY-PIGCGCTNIPSVYTDVFSGLRWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 71/241 (29%)
Tryp_SPc 42..272 CDD:238113 74/244 (30%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 74/244 (30%)
Tryp_SPc 43..263 CDD:214473 71/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.