DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG12133

DIOPT Version :10

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:60 Identity:13/60 - (21%)
Similarity:20/60 - (33%) Gaps:13/60 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DEEFHLRQGDHYCHGRFQVWDPKITTFPGLYLASALVLRPLDACSVYNLRLTSLIAGIIN 93
            |:.||.|.|.    ||.....|.........:.:::|...|         |.|....::|
  Fly    12 DDHFHSRSGP----GRMGEQHPNTCHISAFNMIASIVCGAL---------LLSTATAVVN 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 42..272 CDD:238113 9/52 (17%)
CG12133NP_610540.2 Tryp_SPc 62..317 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.