DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and Jon44E

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:289 Identity:80/289 - (27%)
Similarity:134/289 - (46%) Gaps:53/289 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVIAICL-IRQQRIVDAQFLN--PLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVT-NNSLTHCG 68
            ||...|| :....:|.::...  |:..:....:...|:.||..|.....|::|.:: |:....||
  Fly     4 FVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCG 68

  Fly    69 GSILNSRYILTAAHCV--FPNLRLRLG---EHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNA 128
            |||::..::||||||.  ..::.:..|   .|      :.|.::...||:      .|.|..:|.
  Fly    69 GSIIDHTWVLTAAHCTNSANHVLIYFGASFRH------EAQYTHWVSRSD------MIQHPDWND 121

  Fly   129 ANHVNDIALLKLNRSINFNVHIQPICILLNPASAPSV-ATYQTF--------GWGETKKN-GFPH 183
            ..: |||||:::       .|:. ...|:|....||. ..|.::        |||.|..| |..:
  Fly   122 FLN-NDIALIRI-------PHVD-FWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSN 177

  Fly   184 LLQTAELRAYDAAYCSRSFHA--YMNGNQICAGHE-ERDTCAGDSGGPLVTRVDFDGVKRYLQLG 245
            .|...:::..|...| |:::.  |:..|.||...: .:.:|:||||||||.. |.:.:     :|
  Fly   178 YLNCVDVQIIDNNDC-RNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLH-DNNRI-----VG 235

  Fly   246 IVSYGPTD-CQS--PGVYTYVPNYINWIR 271
            |||:|..: |.:  |..:|.|..|::|||
  Fly   236 IVSFGSGEGCTAGRPAGFTRVTGYLDWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 71/250 (28%)
Tryp_SPc 42..272 CDD:238113 73/252 (29%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 71/250 (28%)
Tryp_SPc 41..266 CDD:238113 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435677
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.