DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and try-9

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:239 Identity:60/239 - (25%)
Similarity:91/239 - (38%) Gaps:75/239 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NNSLTHCGGSILNSRYILTAAHCVFPNLRLRLGEHNIRTD--PDCQGSNCSPRSEEYGI------ 117
            |..:.|..|::::..:|:||||.:           .|..|  |||...|.   .|.|.:      
 Worm    22 NEFVQHGTGTLVSPWHIVTAAHLI-----------GISEDPLPDCDTGNL---REAYFVRDYKNF 72

  Fly   118 ------------MKAITHR-----------FYNAANHV----------NDIALLKLNRSINFNVH 149
                        |....||           .|....:|          ||||:.:|...|.|:..
 Worm    73 VAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFSKD 137

  Fly   150 IQPICILLNPASAPSV-----ATYQTFGWGETKKNGFPHLLQTAELRA-YD-AAYCSRSFHAYMN 207
            |.|.|:    .|||.:     ..|:.||:|....:.   :|::.:|:: |. .|.||..| .|  
 Worm   138 IFPACL----PSAPKIPRIRETGYKLFGYGRDPSDS---VLESGKLKSLYSFVAECSDDF-PY-- 192

  Fly   208 GNQICAGHEERD-TCAGDSGGPLVTRVDFDGVKRYLQLGIVSYG 250
            |...|.....|. :|.||||..:|...|...|:  :.:|::|.|
 Worm   193 GGVYCTSAVNRGLSCDGDSGSGVVRTSDTRNVQ--VLVGVLSAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 60/239 (25%)
Tryp_SPc 42..272 CDD:238113 60/239 (25%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 58/231 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.