DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG17572

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:264 Identity:80/264 - (30%)
Similarity:125/264 - (47%) Gaps:44/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VNGKEAV-------IRSAPFMV-----YVTNNSLTH-CGGSILNSRYILTAAHCVFPNL------ 88
            |.||..|       :.|.||:.     :|...:..: |.|:::..|.|||||||.....      
  Fly   123 VCGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLS 187

  Fly    89 RLRLGEHNIRTDPDCQGSN-CSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQP 152
            .:|:||::..:||||..:. |:|||..:.|...|.|..|....:.:|||||.|...:|::|..||
  Fly   188 SVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQP 252

  Fly   153 ICILLNPASAPSVATYQTFGWGE-----TKKNGFPHLLQTAELRAYDAAYCSRSFHA-------- 204
            ||:....|:..........|||:     .::....||  ...|.::|  .|.|::.:        
  Fly   253 ICLQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHL--DVPLTSWD--LCLRNYGSTGALESPN 313

  Fly   205 YMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDC---QSPGVYTYVPNY 266
            .:.|..:|||.|.:|.|.|..|.||.  :..:|:  :.|:||:|:|..:|   :.|.|||.|.::
  Fly   314 SIEGQWMCAGGEGKDVCQGFGGAPLF--IQENGI--FSQIGIMSFGSDNCGGLRIPSVYTSVAHF 374

  Fly   267 INWI 270
            ..||
  Fly   375 SEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 78/262 (30%)
Tryp_SPc 42..272 CDD:238113 80/264 (30%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 76/249 (31%)
Tryp_SPc 138..378 CDD:214473 74/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.