DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG4650

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:259 Identity:77/259 - (29%)
Similarity:120/259 - (46%) Gaps:32/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTH-CGGSILNSRYILTAAHCVFP 86
            :|:|:..||:         :.|||.|...|:|:|.|:..:.|.: |||:::..:.:||||||...
  Fly    21 SQYLDGRCGL---------LTNGKIANNISSPWMAYLHTSELLYVCGGTVITEKLVLTAAHCTRA 76

  Fly    87 NLRL--RLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVH 149
            :.:|  |:||. |.|| |...:..|    ||.:.:...|..||.....||||:|.|...|.|:..
  Fly    77 SEQLVARIGEF-IGTD-DANDTMLS----EYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKT 135

  Fly   150 IQPICILLNPASAPSVATYQTFG---WGETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNG--- 208
            |:||||:........:...|...   ||...........:..::|...|..||.     :||   
  Fly   136 IRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCST-----LNGTAI 195

  Fly   209 --NQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWI 270
              :|.|||..:...|..|...||...:.|..::||:.:||.:.. ..|:...|||.|.::.::|
  Fly   196 LSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTN-QKCKRASVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 72/239 (30%)
Tryp_SPc 42..272 CDD:238113 73/240 (30%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 72/236 (31%)
Tryp_SPc 33..258 CDD:304450 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463308
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.