DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:250 Identity:68/250 - (27%)
Similarity:103/250 - (41%) Gaps:53/250 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHCV--FPNLRLRLGEHNIRTDPDC 103
            |:.||..|....||:.|.:..:....|||||:...::|||.||:  ..::.:..|. ..||:.. 
  Fly    36 RITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDAASVIVYFGA-TWRTNAQ- 98

  Fly   104 QGSNCSPRSEEYGIMKAITHRFYNA--ANHVN-DIALLKLNRSINFNVHIQPICILLNPASAPSV 165
                             .||...|.  ..|.| ||||:::       .|:. ...::|....||.
  Fly    99 -----------------FTHTVGNGNFIKHSNADIALIRI-------PHVD-FWHMVNKVELPSY 138

  Fly   166 -ATYQTF--------GWGETKKNG-FPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAGH-EERD 219
             ..|..:        |||.|.... .|..||..:|:......|..::.: :..|.||... :.:.
  Fly   139 NDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYGS-VGDNVICTRTVDGKS 202

  Fly   220 TCAGDSGGPLVTRVDFDGVKRYLQLGIVSY-GPTDCQS--PGVYTYVPNYINWIR 271
            .|.|||||||||.   ||.|   .:|:.:: ....|||  |..:..|..:::|||
  Fly   203 ICGGDSGGPLVTH---DGSK---LVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 65/247 (26%)
Tryp_SPc 42..272 CDD:238113 66/248 (27%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 65/247 (26%)
Tryp_SPc 37..253 CDD:238113 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.