DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and psh

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:260 Identity:79/260 - (30%)
Similarity:122/260 - (46%) Gaps:38/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SQTAMRVVNGKEAVIRSAPFMV---YVTNNSLTHCGGSILNSRYILTAAHCVFPNLR----LRLG 93
            :|..:.:|.|........|.|.   |:|..:...||||::.||::|||||||..:..    :|||
  Fly   138 NQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLG 202

  Fly    94 EHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLN 158
            ..||. :||....:...||.:       .|..| ..|..||||:|:|.|.:....:|:|.|:..:
  Fly   203 AVNIE-NPDHSYQDIVIRSVK-------IHPQY-VGNKYNDIAILELERDVVETDNIRPACLHTD 258

  Fly   159 PASAPSVATYQTFGWG--ETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNG-----------NQ 210
            ....||.:.:...|||  .........:|..|.|.......|:.|: |...|           :.
  Fly   259 ATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISY-AEQPGSIRLLKQGVIDSL 322

  Fly   211 ICAGHEE--RDTCAGDSGGPLVTRVDF-DGVKRYLQLGIVSYGPTDCQ--SPGVYTYVPNYINWI 270
            :||..::  .|.|.|||||||:..::. ||:  |..:|::|.| ..|.  :||:||.|.:|:::|
  Fly   323 LCAIDQKLIADACKGDSGGPLIHELNVEDGM--YTIMGVISSG-FGCATVTPGLYTRVSSYLDFI 384

  Fly   271  270
              Fly   385  384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 77/253 (30%)
Tryp_SPc 42..272 CDD:238113 78/254 (31%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 77/253 (30%)
Tryp_SPc 144..387 CDD:238113 78/254 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.