DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG31220

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:280 Identity:94/280 - (33%)
Similarity:135/280 - (48%) Gaps:50/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PLCGVTYESQTAMRVVNGKEAVIRSAPF--MVYVTNNS--------LTHCGGSILNSRYILTAAH 82
            |.||   :.||..||:.|.|..:...|:  |:...|.|        :..||||::|:||:|||||
  Fly    93 PDCG---KPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAH 154

  Fly    83 CVFPNL----RLRLGEHNIRTDPDC--QGSN--CSPRSEEYGIMKAITHRFYNAANHV--NDIAL 137
            ||...:    |:|||||....:|||  :|:.  |:|...:..:....:|..|:.||:.  |||||
  Fly   155 CVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIAL 219

  Fly   138 LKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGF----PHLLQTAELRAYDAAYC 198
            ::|...:.:.:...|||:|..|.|......| ..|||:|   |.    ..:|:.|.::......|
  Fly   220 VRLKEPVRYTMAYYPICVLDYPRSLMKFKMY-VAGWGKT---GMFDTGSKVLKHAAVKVRKPEEC 280

  Fly   199 SRSF-HAYMNGN-QICAGH-EERDTCAGDSGGPLVTRVDFDGV--KRYLQL----GIVSYGPTDC 254
            |..: |.:.... |||||. :.|.||.||||.||:      |.  :.|..:    ||.||| ..|
  Fly   281 SEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLM------GTSGRSYETITFLAGITSYG-GPC 338

  Fly   255 QS---PGVYTYVPNYINWIR 271
            .:   |.|:|....:..|||
  Fly   339 GTIGWPSVFTRTAKFYKWIR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 86/264 (33%)
Tryp_SPc 42..272 CDD:238113 88/266 (33%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 86/264 (33%)
Tryp_SPc 104..360 CDD:238113 88/266 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.