DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG31269

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:282 Identity:87/282 - (30%)
Similarity:124/282 - (43%) Gaps:53/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIAICLIR-QQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTH-CGGSI 71
            :::|..|| :....|.:|        |:.|   |::.|:.|....||:.:.:...|..| |||:|
  Fly    15 LVSITAIRIKGNSTDGRF--------YKDQ---RIIGGQAAEDGFAPYQISLQGISGAHSCGGAI 68

  Fly    72 LNSRYILTAAHCV----FPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAI-THRFYNAANH 131
            :|..::|||||||    .|.|.:..|.:...          .|....:  :||| .|..|:....
  Fly    69 INETFVLTAAHCVENAFIPWLVVVTGTNKYN----------QPGGRYF--LKAIHIHCNYDNPEM 121

  Fly   132 VNDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNG-FPHLLQTAELRAYDA 195
            .||||||:|...|.::...|||.:.|.|.. |......| |||.|...| .|..||...|:....
  Fly   122 HNDIALLELVEPIAWDERTQPIPLPLVPMQ-PGDEVILT-GWGSTVLWGTSPIDLQVLYLQYVPH 184

  Fly   196 AYCSRSFHAYMNGNQIC-AGH------EERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYG-PT 252
            ..|.    |.::.::.| .||      .....|.||||||||:       ..|| :|:|::| |.
  Fly   185 RECK----ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVS-------NGYL-VGLVNWGWPC 237

  Fly   253 DCQSPGVYTYVPNYINWIRRAM 274
            ....|.|:..|..|.:|||..|
  Fly   238 ATGVPDVHASVYFYRDWIRNVM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 76/243 (31%)
Tryp_SPc 42..272 CDD:238113 77/244 (32%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/243 (31%)
Tryp_SPc 38..258 CDD:238113 78/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.