DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and sphinx1

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:272 Identity:58/272 - (21%)
Similarity:116/272 - (42%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVT-----NNSLTHCGGSILNSRYILT 79
            :|....|:....|..:::.:.|:..|..|...:..::|.:.     .:||.:..|:|:::::|||
  Fly     4 VVTLLVLSLTVSVGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILT 68

  Fly    80 AAHCVFPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAI--THRFYNAANHVNDIALLKLNR 142
                |...|:....|.::.:....:|         :.|::..  ..||:...:||  |||:|...
  Fly    69 ----VKTVLKYSYIEVHLASRRSYRG---------FDIIRIYKENFRFHYDNDHV--IALVKCPY 118

  Fly   143 SINFNVHIQPICILLNPASAPSVATY-----QTFGWGETKKNG-FPHLLQTAELRAYDAAYCSRS 201
            . .|:..:..:.:   ||.......|     ...|:|..|::. .|..::..|:...:...|:: 
  Fly   119 Q-KFDRRMDRVRV---PAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAK- 178

  Fly   202 FHAYMNGNQIC-AGHEERDTCAGDSGGPLVT---RVDFDGVKRYLQLGIVSYGPTDCQ--SPGVY 260
            ::..:...::| :|...:..|.||.||.:||   ...|        :||:...|.:|.  .|.|:
  Fly   179 YYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTF--------IGIIWLMPENCSIGYPSVH 235

  Fly   261 TYVPNYINWIRR 272
            ..|.::|.||:|
  Fly   236 IRVSDHIKWIKR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 52/247 (21%)
Tryp_SPc 42..272 CDD:238113 53/248 (21%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 52/247 (21%)
Tryp_SPc 26..248 CDD:304450 54/250 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.