DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG18636

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:256 Identity:89/256 - (34%)
Similarity:145/256 - (56%) Gaps:7/256 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYV-TNNSLTHCGGSILNSRYILTAAHCVFP 86
            :|||:|.||:..:|:||.|::||..|...|:|:||:: :...:..||||::..:.:||||||...
  Fly    26 SQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIA 90

  Fly    87 NLRL--RLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVH 149
            |..|  ||||:......:|.|..|:.| ||:.:.....|:.|:...|.||||:|:|::|:.:..:
  Fly    91 NQHLVARLGEYERTRSEECTGYYCNFR-EEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDN 154

  Fly   150 IQPICILLNPA---SAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQI 211
            |:|||::.:..   ....:......|||:|:.......|||.::|......|::.....:.|||.
  Fly   155 IRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQF 219

  Fly   212 CAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWIRR 272
            |||:.:.:.|.|||||||...:.....:|::|:||.||...:||...|:|.|.::..:|.|
  Fly   220 CAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVLSHAEFILR 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 78/234 (33%)
Tryp_SPc 42..272 CDD:238113 78/235 (33%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 78/234 (33%)
Tryp_SPc 45..278 CDD:238113 77/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463296
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.890

Return to query results.
Submit another query.