DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG33225

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:278 Identity:89/278 - (32%)
Similarity:143/278 - (51%) Gaps:14/278 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AWFVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGS 70
            |..|:...|:...|:..:..|...||.|.......|||.|.:|...:.|:||.|...:...|.||
  Fly    21 AEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGS 85

  Fly    71 ILNSRYILTAAHCV--FPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITH-RFYNAANHV 132
            ::...::||:|.|:  .|. ::.|||:    |.:|..::|:...:...|.:.|.| :|.......
  Fly    86 LITRLFVLTSASCLLSLPK-QVILGEY----DRNCTSADCTSIRQVIDIDQKIIHGQFGLETVKK 145

  Fly   133 NDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAY 197
            .|||||:|.:.::.:.:::|||:.::.....||..:...|||.|:.|....:|||..|...:..|
  Fly   146 YDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSKINRKY 210

  Fly   198 CSRSFHAYMNGNQICAGHEERDTCAGDSGGP--LVTRVDFDG----VKRYLQLGIVSYGPTDCQS 256
            |.......::.:|:|.|...:|||:||:|||  |..::|.||    ..|...:||||||.:.|..
  Fly   211 CKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSG 275

  Fly   257 PGVYTYVPNYINWIRRAM 274
            .||||.|.:|::||.|.:
  Fly   276 IGVYTNVEHYMDWIVRTI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 78/237 (33%)
Tryp_SPc 42..272 CDD:238113 79/238 (33%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 78/237 (33%)
Tryp_SPc 57..292 CDD:238113 79/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.