DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG33458

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:254 Identity:92/254 - (36%)
Similarity:132/254 - (51%) Gaps:10/254 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHCV---FPNLRLR 91
            ||:   |:...|:..|:::.:...|::.|:..||...||||:||..::||||||.   ...:.:|
  Fly    29 CGI---SKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDKNAKVLVR 90

  Fly    92 LGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICIL 156
            |||::.....||..|.|:....||.||:.:.|..|..| |..||||.||||.:.:...|:|||::
  Fly    91 LGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTA-HYYDIALAKLNRYVVYTDSIRPICLM 154

  Fly   157 LNPASAPSVATYQTF---GWGETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAGHEER 218
            |||.....|.|.:.|   |||.|..:.....||...:...|...|...|...::...||||..:.
  Fly   155 LNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICAGESKH 219

  Fly   219 DTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWIRRAMLIN 277
            ....|||||||.:.||:...||:.|.||||:.........|:|.:.:|.|||.|.::.|
  Fly   220 YVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGVSVFTNILSYSNWIHRTIITN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 85/234 (36%)
Tryp_SPc 42..272 CDD:238113 86/235 (37%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 85/234 (36%)
Tryp_SPc 38..274 CDD:238113 86/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.