DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30087 and CG30289

DIOPT Version :9

Sequence 1:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:273 Identity:92/273 - (33%)
Similarity:147/273 - (53%) Gaps:9/273 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIA--ICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSI 71
            |||  :||......|.::.|...||::.:......:..|.:..|:..|:||.|.::.  .||||:
  Fly     7 VIAALVCLFIANNNVMSRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMVLVWSSK--PCGGSL 69

  Fly    72 LNSRYILTAAHCV-FPNLRLRLGEH-NIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVND 134
            :..:::||||||| |.:|.:|||:: .:...|.|..::|.|:.....:...|.|..||.....||
  Fly    70 IARQFVLTAAHCVSFEDLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQND 134

  Fly   135 IALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAYCS 199
            ||||:::.::.::.:::|||:|:. ....|:..:...|||||:...|..:|..|.|...|.:||:
  Fly   135 IALLRMSEAVEYSDYVRPICLLVG-EQMQSIPMFTVTGWGETEYGQFSRILLNATLYNMDISYCN 198

  Fly   200 RSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQS--PGVYTY 262
            ..|:...:.:|||||....:||.|||||||.::..:.......|.|:||||...|.:  .||||.
  Fly   199 IKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTN 263

  Fly   263 VPNYINWIRRAML 275
            |..:..||...|:
  Fly   264 VSYHREWIFNKMV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 80/232 (34%)
Tryp_SPc 42..272 CDD:238113 82/233 (35%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 80/231 (35%)
Tryp_SPc 42..271 CDD:238113 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.860

Return to query results.
Submit another query.